Recombinant Human Growth/differentiation factor 15(GDF15),partial

As low as $212.00
In stock
Product Code
CSB-EP859530HU
Product Code: CSB-EP859530HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. Q99988
Target/Protein GDF15
Species of origin Homo sapiens (Human)
AA Sequence RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Protein description Partial
MW of Fusion Proten 16.2 kDa
Expression Region 198-308aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Growth/differentiation factor 15(GDF15),partial
Your Rating