Recombinant Human Vitamin D-binding protein(GC),partial

$191.00
In stock
Product Code
CSB-YP009306HU
Product Inquiry
Product Code: CSB-YP009306HU
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: Yeast
More Information
Alternative names Gc protein-derived macrophage activating factor
Uniprot NO. P02774
Target/Protein GC
Species of origin Homo sapiens (Human)
AA Sequence RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
Biologically Active Not Test
Nature Recombinant
Protein description Partial of NM_000583.3
MW of Fusion Proten 67 kDa
Expression Region 19-474aa
Expression System Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-sumostar-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Serum vitamin D-binding protein is a third member of the albumin and alpha fetoprotein gene family." Cooke N.E., David E.V. J. Clin. Invest. 76:2420-2424(1985)
Relevance Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
Research areas Signal Transduction

Write Your Own Review
You're reviewing:Recombinant Human Vitamin D-binding protein(GC),partial
Your Rating