*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Trans-acting T-cell-specific transcription factor GATA-3(GATA3)

As low as $1,205.00
In stock
Product Code
CSB-EP009276HU
Product Code: CSB-EP009276HU
Size: 20μg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P23771
Target/Protein GATA3
Species of origin Homo sapiens (Human)
AA Sequence MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT PMHPPSSLSFGPHHPSSMVTAMG
Protein description Full Length
MW of Fusion Proten Inquire
Expression Region 1-443
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info The tag type will be determined during production process.

Write Your Own Review
You're reviewing:Recombinant Human Trans-acting T-cell-specific transcription factor GATA-3(GATA3)
Your Rating