Recombinant Mouse Galactocerebrosidase(Galc)

As low as $1,044.00
In stock
Product Code
CSB-CF009196MO
Product Code: CSB-CF009196MO
Size: 20μg/100μg
Species: Mus musculus (Mouse)
Express system: In Vitro E.coli
More Information
Alternative names Galactocerebroside beta-galactosidase Galactosylceramidase Galactosylceramide beta-galactosidase
Uniprot NO. P54818
Target/Protein Galc
Species of origin Mus musculus (Mouse)
AA Sequence YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Protein description Full length of mature protein
MW of Fusion Proten 73.1 kDa
Expression Region 43-684aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info Tag-Free
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Mouse Galactocerebrosidase(Galc)
Your Rating