Recombinant Human Fibronectin(FN1),partial

$39.00
In stock
Product Code
CSB-AP005751HU
Product Inquiry
Product Code: CSB-AP005751HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: E.coli
More Information
Alternative names NovoNectin;Fibronectin; FN; Cold-insoluble globulin; CIG; FN; Fibronectin 1
Uniprot NO. P02751
Target/Protein FN1
Species of origin Homo sapiens (Human)
AA Sequence PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS & AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST
Activity Data Specific activity as determined by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells is greater than 50%. When 1×10^5 cells/well are added to plates coated with fibronectin (7-13 ng/mL and 100μL/well),approximately 50%-80% will adhere specifically after 30 minutes at 37°C.
Protein description Dimer
MW of Fusion Proten 62.7 kDa
Expression Region 1270-1546aa & 1721-2016aa
Expression System E.coli
Purity Greater than 95% as determined by SDS-PAGE.
Tag info Tag-Free
Storage Lyophilized from a 0.2 μm Filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2
Relevance Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains,fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ~63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II,and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result.
Research areas Cancer

Write Your Own Review
You're reviewing:Recombinant Human Fibronectin(FN1),partial
Your Rating