Recombinant Human Fatty acid-binding protein (FABP5)

As low as $212.00
In stock
Product Code
CSB-EP007946HUe0
Product Code: CSB-EP007946HUe0
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. Q01469
Target/Protein FABP5
Species of origin Homo sapiens (Human)
AA Sequence MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Protein description Full Length
MW of Fusion Proten 42.2 kDa
Expression Region 1-135aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal GST-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Fatty acid-binding protein (FABP5)
Your Rating