*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human TFIIH basal transcription factor complex helicase XPD subunit(ERCC2)

As low as $1,698.00
In stock
Product Code
CSB-EP007770HU
Product Code: CSB-EP007770HU
Size: 20μg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P18074
Target/Protein ERCC2
Species of origin Homo sapiens (Human)
AA Sequence MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQ RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPE VTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDL KALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG LAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA AQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
Protein description Full Length
MW of Fusion Proten Inquire
Expression Region 1-760
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info The tag type will be determined during production process.

Write Your Own Review
You're reviewing:Recombinant Human TFIIH basal transcription factor complex helicase XPD subunit(ERCC2)
Your Rating