Recombinant Human Endothelin-1 receptor(EDNRA)

As low as $2,213.00
In stock
Product Code
CSB-CF007403HU
Product Code: CSB-CF007403HU
Size: 20μg/100μg
Species: Homo sapiens (Human)
Express system: In Vitro E.coli
More Information
Alternative names Endothelin A receptor
Uniprot NO. P25101
Target/Protein EDNRA
Species of origin Homo sapiens (Human)
AA Sequence DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Protein description Full length of mature protein
MW of Fusion Proten 48.5 kDa
Expression Region 21-427aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info C-terminal 10xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Endothelin-1 receptor(EDNRA)
Your Rating