Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

As low as $388.00
In stock
Product Code
CSB-EP007139RA
Product Code: CSB-EP007139RA
Size: 20μg/100μg/1mg
Species: Rattus norvegicus (Rat)
Express system: E.coli
More Information
Uniprot NO. P14740
Target/Protein Dpp4
Species of origin Rattus norvegicus (Rat)
AA Sequence SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Protein description Partial
MW of Fusion Proten 30.7 kDa
Expression Region 638-767aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-SUMO-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial
Your Rating