Recombinant Human Dermcidin(DCD)

$162.00
In stock
Product Code
CSB-EP006537HUa6
Product Inquiry
Product Code: CSB-EP006537HUa6
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Application: SDS-PAGE
Express system: E.coli
More Information
Alternative names Preproteolysin
Uniprot NO. P81605
Target/Protein DCD
Species of origin Homo sapiens (Human)
AA Sequence YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 23.3 kDa
Expression Region 20-110aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-B2M-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Dermcidin: a novel human antibiotic peptide secreted by sweat glands." Schittek B., Hipfel R., Sauer B., Bauer J., Kalbacher H., Stevanovic S., Schirle M., Schroeder K., Blin N., Meier F., Rassner G., Garbe C. Nat. Immunol. 2:1133-1137(2001)
Relevance DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity. Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG.
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Human Dermcidin(DCD)
Your Rating