Recombinant Human Interleukin-8(CXCL8)

As low as $124.00
In stock
Product Code
CSB-AP004641HU
Product Code: CSB-AP004641HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: Mammalian cell
More Information
Alternative names Interleukin-8; IL-8; C-X-C Motif Chemokine 8;CXCL8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1
Uniprot NO. P10145
Target/Protein CXCL8
Species of origin Homo sapiens (Human)
AA Sequence EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Activity Data The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 25 ng/mL.
Protein description Full length of mature protein
MW of Fusion Proten 10.1 kDa
Expression Region 21-99aa
Expression System Mammalian Cell
Purity Greater than 95% as determined by SDS-PAGE.
Tag info C-terminal 6xHis-tagged
Storage Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Relevance Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-8(CXCL8)
Your Rating