Recombinant Human Interleukin-8(CXCL8),partial

As low as $130.00
In stock
Product Code
CSB-AP004611HU
Product Code: CSB-AP004611HU
Size: 10μg/50μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: E.coli
More Information
Alternative names Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8
Uniprot NO. P10145
Target/Protein CXCL8
Species of origin Homo sapiens (Human)
AA Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Activity Data The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 5 ng/mL.
Protein description Partial
MW of Fusion Proten 8.45 kDa
Expression Region 28-99aa
Expression System E.coli
Purity Greater than 95% as determined by SDS-PAGE.
Tag info Tag-Free
Storage Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Relevance Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Human Interleukin-8(CXCL8),partial
Your Rating