Recombinant Dog Minor allergen Can f 2

$298.00
In stock
Product Code
CSB-EP521201DO
Product Inquiry
Product Code: CSB-EP521201DO
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Canis lupus familiaris (Dog) (Canis familiaris)
Express system: E.coli
More Information
Alternative names Allergen Dog 2 Allergen: Can f 2
Uniprot NO. O18874
Species of origin Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
Biologically Active Not Test
Nature Recombinant
Protein description Full Length of Mature Protein
MW of Fusion Proten 34.4 kDa
Expression Region 19-180aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "The major dog allergens, Can f 1 and Can f 2, are salivary lipocalin proteins: cloning and immunological characterization of the recombinant forms."Konieczny A., Morgenstern J.P., Bizinkauskas C.B., Lilley C.H., Brauer A.W., Bond J.F., Aalberse R.C., Wallner B.P., Kasaian M.T.Immunology 92:577-586(1997)
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Dog Minor allergen Can f 2
Your Rating