Recombinant Rat Carboxypeptidase A1(Cpa1)

$154.00
In stock
Product Code
CSB-EP005875RA
Product Inquiry
Product Code: CSB-EP005875RA
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Rattus norvegicus (Rat)
Application: SDS-PAGE
Express system: E.coli
More Information
Alternative names Cpa
Uniprot NO. P00731
Target/Protein Cpa1
Species of origin Rattus norvegicus (Rat)
AA Sequence ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY
Biologically Active Not Test
Nature Recombinant
Protein length Full Length of Mature Protein
MW of Fusion Proten 39.6 kDa
Expression Region 111-419aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Rat preprocarboxypeptidase A: cDNA sequence and preliminary characterization of the gene." Quinto C., Quiroga M., Swain W.F., Nikovits W.C. Jr., Standring D.N., Pictet R.L., Valenzuela P., Rutter W.J. Proc. Natl. Acad. Sci. U.S.A. 79:31-35(1982)
Relevance Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.
Research areas Signal Transduction

Write Your Own Review
You're reviewing:Recombinant Rat Carboxypeptidase A1(Cpa1)
Your Rating