Recombinant Rat Carboxypeptidase A1(Cpa1)
As low as
$162.00
In stock
Product Code
CSB-EP005875RA
Product Code: CSB-EP005875RA
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Rattus norvegicus (Rat)
Application: SDS-PAGE
Express system: E.coli
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Rattus norvegicus (Rat)
Application: SDS-PAGE
Express system: E.coli
Alternative names | Cpa |
---|---|
Uniprot NO. | P00731 |
Target/Protein | Cpa1 |
Species of origin | Rattus norvegicus (Rat) |
AA Sequence | ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY |
Biologically Active | Not Test |
Nature | Recombinant |
Protein description | Full length of mature protein |
MW of Fusion Proten | 39.6 kDa |
Expression Region | 111-419aa |
Expression System | E.coli |
Purity | Greater than 85% as determined by SDS-PAGE. |
Application | SDS-PAGE |
Tag info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Reference | "Rat preprocarboxypeptidase A: cDNA sequence and preliminary characterization of the gene." Quinto C., Quiroga M., Swain W.F., Nikovits W.C. Jr., Standring D.N., Pictet R.L., Valenzuela P., Rutter W.J. Proc. Natl. Acad. Sci. U.S.A. 79:31-35(1982) |
Relevance | Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. |
Research areas | Signal Transduction |
Write Your Own Review
Recombinant Rat Carboxypeptidase A1(Cpa1) Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.