Recombinant Human C-type lectin domain family 4 member C(CLEC4C), partial

As low as $162.00
In stock
Product Code
CSB-EP855470HU
Product Inquiry
Product Code: CSB-EP855470HU
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: E.coli
More Information
Alternative names Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303
Uniprot NO. Q8WTT0
Target/Protein CLEC4C
Species of origin Homo sapiens (Human)
AA Sequence NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Biologically Active Active
Nature Recombinant
Activity Data Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 λg/ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 λg/ml.
Protein description Extracellular Domain
MW of Fusion Proten 36 kDa
Expression Region 45-213aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001)
Relevance Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Human C-type lectin domain family 4 member C(CLEC4C), partial
Your Rating