Recombinant Human C-type lectin domain family 4 member C(CLEC4C),parial

$162.00
In stock
Product Code
CSB-EP855470HU
Product Inquiry
Product Code: CSB-EP855470HU
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Homo sapiens (Human)
Express system: E.coli
More Information
Alternative names Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303
Uniprot NO. Q8WTT0
Target/Protein CLEC4C
Species of origin Homo sapiens (Human)
AA Sequence NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Biologically Active Active
Nature Recombinant
Activity Data Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 λg/ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 λg/ml.
Protein description Extracellular Domain
MW of Fusion Proten 36 kDa
Expression Region 45-213aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Storage Tris-based buffer,50% glycerol
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001)
Relevance Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
Research areas Immunology

Write Your Own Review
You're reviewing:Recombinant Human C-type lectin domain family 4 member C(CLEC4C),parial
Your Rating