Recombinant Human CD63 antigen(CD63),partial

As low as $368.00
In stock
Product Code
CSB-YP004950HU1a4
Product Code: CSB-YP004950HU1a4
Size: 20μg/100μg/500μg
Species: Homo sapiens (Human)
Express system: Yeast
More Information
Uniprot NO. P08962
Target/Protein CD63
Species of origin Homo sapiens (Human)
AA Sequence AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Protein description Partial
MW of Fusion Proten 27.5 kDa
Expression Region 103-203aa
Expression System Yeast
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-sumostar-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human CD63 antigen(CD63),partial
Your Rating