Recombinant Human CD63 antigen(CD63),partial

As low as $306.00
In stock
Product Code
CSB-EP004950HU1
Product Code: CSB-EP004950HU1
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P08962
Target/Protein CD63
Species of origin Homo sapiens (Human)
AA Sequence AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Protein description Partial
MW of Fusion Proten 15.5 kDa
Expression Region 103-203aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human CD63 antigen(CD63),partial
Your Rating