*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Signal transducer CD24(CD24)

As low as $162.00
In stock
Product Code
CSB-RP104644h
Product Code: CSB-RP104644h
Size: 10μg/200μg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Alternative names Small cell lung carcinoma cluster 4 antigen; CD24
Uniprot NO. P25063
Target/Protein CD24
Species of origin Homo sapiens (Human)
AA Sequence SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Protein description Full length of mature protein
MW of Fusion Proten 32.3 kDa
Expression Region 27-80aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal GST-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Signal transducer CD24(CD24)
Your Rating