*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Monocyte differentiation antigen CD14(CD14)

As low as $440.00
In stock
Product Code
CSB-MP004879HU
Product Code: CSB-MP004879HU
Size: 20μg/100μg/500μg
Species: Homo sapiens (Human)
Express system: Mammalian cell
More Information
Uniprot NO. P08571
Target/Protein CD14
Species of origin Homo sapiens (Human)
AA Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Protein description Full length of mature protein
MW of Fusion Proten 39.2 kDa
Expression Region 20-345aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Monocyte differentiation antigen CD14(CD14)
Your Rating