*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human C-C chemokine receptor type 8(CCR8),partial,Nanodiscs

As low as $1,038.00
In stock
Product Code
CSB-CF004847HU2-N
Product Code: CSB-CF004847HU2-N
Size: 20μg/100μg
Species: Homo sapiens (Human)
Express system: In Vitro E.coli
More Information
Alternative names CC chemokine receptor CHEMR1;CMKBRL2Chemokine receptor-like 1;CKR-L1;GPR-CY6;GPRCY6;TER1;CDw198
Uniprot NO. P51685
Target/Protein CCR8
Species of origin Homo sapiens (Human)
AA Sequence LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV
Protein description Partial
MW of Fusion Proten 9.4 kDa
Expression Region 74-129aa
Expression System In vitro E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 10xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human C-C chemokine receptor type 8(CCR8),partial,Nanodiscs
Your Rating