The store will not work correctly in the case when cookies are disabled.
JavaScript seems to be disabled in your browser.
For the best experience on our site, be sure to turn on Javascript in your browser.
Recombinant Human C-C chemokine receptor type 5(CCR5)
As low as
$2,126.00
In stock
Product Code
CSB-CF004844HU
Lead Time 18-23 business days
We only ship directly to the USA right now.
For customers outside the USA, feel free to contact
your local distributors .
Product Code : CSB-CF004844HUSize : 20μg/100μgSpecies : Homo sapiens (Human)Express system : In Vitro E.coli
More Information
Alternative names
CHEMR13 (HIV-1 fusion coreceptor) (CD_antigen: CD195) (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (CMKBR5)
Uniprot NO.
P51681
Target/Protein
CCR5
Species of origin
Homo sapiens (Human)
AA Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Protein description
Full Length
MW of Fusion Proten
43.9 kDa
Expression Region
1-352aa
Expression System
In vitro E.coli
Purity
Greater than 85% as determined by SDS-PAGE.
Tag info
N-terminal 10xHis-tagged
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Recombinant Human C-C chemokine receptor type 5(CCR5) Images
