*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Mouse C-C motif chemokine 2(Ccl2),partial

As low as $306.00
In stock
Product Code
CSB-EP004783MO
Product Code: CSB-EP004783MO
Size: 20μg/100μg/1mg
Species: Mus musculus (Mouse)
Express system: E.coli
More Information
Uniprot NO. P10148
Target/Protein CCL2
Species of origin Mus musculus (Mouse)
AA Sequence QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Protein description Partial
MW of Fusion Proten 12.4 kDa
Expression Region 24-96aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Mouse C-C motif chemokine 2(Ccl2),partial
Your Rating