Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)- Cusabio

More Information
Alternative names	1,2-CTD
Uniprot NO.	P07773
Target/Protein	catA
Species of origin	Acinetobacter baylyi
AA Sequence	MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV
Biologically Active	Not Test
Nature	Recombinant
Protein description	Full Length
MW of Fusion Proten	50.3 kDa
Expression Region	1-311aa
Expression System	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
Application	SDS-PAGE
Tag info	N-terminal 6xHis-SUMO-tagged
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference	"DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions."Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.J. Bacteriol. 170:4874-4880(1988)
Relevance	Catechol + O2 = cis,cis-muconate.
Research areas	Microbiology

Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)