Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)
As low as
$298.00
In stock
Product Code
CSB-EP357202AWW
Product Code: CSB-EP357202AWW
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Acinetobacter baylyi
Express system: E.coli
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Acinetobacter baylyi
Express system: E.coli
Alternative names | 1,2-CTD |
---|---|
Uniprot NO. | P07773 |
Target/Protein | catA |
Species of origin | Acinetobacter baylyi |
AA Sequence | MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV |
Biologically Active | Not Test |
Nature | Recombinant |
Protein description | Full Length |
MW of Fusion Proten | 50.3 kDa |
Expression Region | 1-311aa |
Expression System | E.coli |
Purity | Greater than 90% as determined by SDS-PAGE. |
Application | SDS-PAGE |
Tag info | N-terminal 6xHis-SUMO-tagged |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Reference | "DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions."Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.J. Bacteriol. 170:4874-4880(1988) |
Relevance | Catechol + O2 = cis,cis-muconate. |
Research areas | Microbiology |
Write Your Own Review
Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA) Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.