Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)

$298.00
In stock
Product Code
CSB-EP357202AWW
Product Inquiry
Product Code: CSB-EP357202AWW
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Acinetobacter baylyi
Express system: E.coli
More Information
Alternative names 1,2-CTD
Uniprot NO. P07773
Target/Protein catA
Species of origin Acinetobacter baylyi
AA Sequence MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV
Biologically Active Not Test
Nature Recombinant
Protein length Full Length
MW of Fusion Proten 50.3 kDa
Expression Region 1-311aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 6xHis-SUMO-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions."Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.J. Bacteriol. 170:4874-4880(1988)
Relevance Catechol + O2 = cis,cis-muconate.
Research areas Microbiology

Write Your Own Review
You're reviewing:Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase(catA)
Your Rating