*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human Complement C4-B(C4B),partial

As low as $250.00
In stock
Product Code
CSB-YP313364HU
Product Code: CSB-YP313364HU
Size: 20μg/100μg/500μg
Species: Homo sapiens (Human)
Express system: Yeast
More Information
Uniprot NO. P0C0L5
Target/Protein C4B
Species of origin Homo sapiens (Human)
AA Sequence EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Protein description Partial
MW of Fusion Proten 35.1 kDa
Expression Region 1454-1744aa
Expression System Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Complement C4-B(C4B),partial
Your Rating