Recombinant Human Basigin(BSG),partial

As low as $396.00
In stock
Product Code
CSB-MP002831HU
Product Code: CSB-MP002831HU
Size: 20μg/100μg/1mg
Species of origin: Human
Express system: Mammalian cell
More Information
Uniprot NO. P35613
Target/Protein BSG/CD147
Species of origin Human
AA Sequence EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
Protein description Partial
MW of Fusion Proten 49.3 kDa
Expression Region 138-323aa
Expression System Mammalian Cell
Purity Greater than 85% as determined by SDS-PAGE.
Tag info C-terminal hFc-tagged
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Not test.

Write Your Own Review
You're reviewing:Recombinant Human Basigin(BSG),partial
Your Rating