Recombinant Escherichia coli Beta-lactamase TEM(bla)
As low as
$298.00
In stock
Product Code
CSB-EP352353ENL
Product Code: CSB-EP352353ENL
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Escherichia coli (strain K12)
Express system: E.coli
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Escherichia coli (strain K12)
Express system: E.coli
Alternative names | IRT-4PenicillinaseTEM-1TEM-16/CAZ-7TEM-2TEM-24/CAZ-6TEM-3TEM-4TEM-5TEM-6TEM-8/CAZ-2 |
---|---|
Uniprot NO. | P62593 |
Target/Protein | bla |
Species of origin | Escherichia coli (strain K12) |
AA Sequence | HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW |
Biologically Active | Not Test |
Nature | Recombinant |
Protein description | Full length of mature protein |
MW of Fusion Proten | 44.9 kDa |
Expression Region | 24-286aa |
Expression System | E.coli |
Purity | Greater than 90% as determined by SDS-PAGE. |
Application | SDS-PAGE |
Tag info | N-terminal 6xHis-SUMO-tagged |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Reference | Beta-lactamase TEM1 of E. coli. Crystal structure determination at 2.5-A resolution.Jelsch C., Lenfant F., Masson J.-M., Samama J.-P.FEBS Lett. 299:135-142(1992) |
Relevance | T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors. |
Research areas | Others |
Write Your Own Review
Recombinant Escherichia coli Beta-lactamase TEM(bla) Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.