Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial

As low as $306.00
In stock
Product Code
CSB-RP166394r
Product Code: CSB-RP166394r
Size: 20μg/100μg/1mg
Species: Rattus norvegicus (Rat)
Express system: E.coli
More Information
Uniprot NO. P23363
Target/Protein Bdnf
Species of origin Rattus norvegicus (Rat)
AA Sequence RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL
Protein description Partial
MW of Fusion Proten 16.3 kDa
Expression Region 136-243aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial
Your Rating