Recombinant Human Apoptosis regulator Bcl-2(BCL2),partial

As low as $212.00
In stock
Product Code
CSB-EP002611HU1
Product Code: CSB-EP002611HU1
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P10415
Target/Protein BCL2
Species of origin Homo sapiens (Human)
AA Sequence AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Protein description Partial
MW of Fusion Proten 25.2 kDa
Expression Region 2-211aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info C-terminal 10xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Apoptosis regulator Bcl-2(BCL2),partial
Your Rating