Recombinant Human Cyclic AMP-dependent transcription factor ATF-3(ATF3)

As low as $256.00
In stock
Product Code
CSB-EP002271HU
Product Code: CSB-EP002271HU
Size: 20μg/100μg/1mg
Species: Homo sapiens (Human)
Express system: E.coli
More Information
Uniprot NO. P18847
Target/Protein ATF3
Species of origin Homo sapiens (Human)
AA Sequence MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Protein description Full Length
MW of Fusion Proten 26.1 kDa
Expression Region 1-181aa
Expression System E.coli
Purity Greater than 85% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human Cyclic AMP-dependent transcription factor ATF-3(ATF3)
Your Rating