Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)

$289.00
In stock
Product Code
CSB-EP365470BQT
Product Inquiry
Product Code: CSB-EP365470BQT
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Bacillus licheniformis
Application: SDS-PAGE
Express system: E.coli
More Information
Uniprot NO. P00780
Target/Protein apr
Species of origin Bacillus licheniformis
AA Sequence AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Biologically Active Not Test
Nature Recombinant
Protein length Full Length of Mature Protein
MW of Fusion Proten 45.8 kDa
Expression Region 106-379aa
Expression System E.coli
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 10xHis-SUMO-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference "Subtilisin Carlsberg. V. The complete sequence; comparison with subtilisin BPN'; evolutionary relationships." Smith E.L., Delange R.J., Evans W.H., Landon M., Markland F.S. J. Biol. Chem. 243:2184-2191(1968)
Relevance Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)
Your Rating