Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)
As low as
$298.00
In stock
Product Code
CSB-EP365470BQT
Product Code: CSB-EP365470BQT
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Bacillus licheniformis
Application: SDS-PAGE
Express system: E.coli
Size: 10μg/50μg/100μg/200μg/500μg/1mg
Species of origin: Bacillus licheniformis
Application: SDS-PAGE
Express system: E.coli
Uniprot NO. | P00780 |
---|---|
Target/Protein | apr |
Species of origin | Bacillus licheniformis |
AA Sequence | AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ |
Biologically Active | Not Test |
Nature | Recombinant |
Protein description | Full length of mature protein |
MW of Fusion Proten | 45.8 kDa |
Expression Region | 106-379aa |
Expression System | E.coli |
Purity | Greater than 90% as determined by SDS-PAGE. |
Application | SDS-PAGE |
Tag info | N-terminal 10xHis-SUMO-tagged |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Reference | "Subtilisin Carlsberg. V. The complete sequence; comparison with subtilisin BPN'; evolutionary relationships." Smith E.L., Delange R.J., Evans W.H., Landon M., Markland F.S. J. Biol. Chem. 243:2184-2191(1968) |
Relevance | Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides. |
Research areas | Others |
Write Your Own Review
Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr) Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365470BQT could indicate that this peptide derived from E.coli-expressed Bacillus licheniformis apr.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365470BQT could indicate that this peptide derived from E.coli-expressed Bacillus licheniformis apr.