The store will not work correctly in the case when cookies are disabled.
JavaScript seems to be disabled in your browser.
For the best experience on our site, be sure to turn on Javascript in your browser.
Recombinant Mouse Apolipoprotein C-I(Apoc1)
As low as
$838.00
In stock
Product Code
CSB-CF001930MO
Lead Time 3-7 business days
We only ship directly to the USA right now.
For customers outside the USA, feel free to contact
your local distributors .
Product Code : CSB-CF001930MOSize : 20μg/100μgSpecies : Mus musculus (Mouse)Express system : In Vitro E.coli
More Information
Alternative names
Apolipoprotein C1
Uniprot NO.
P34928
Target/Protein
Apoc1
Species of origin
Mus musculus (Mouse)
AA Sequence
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Protein description
Full length of mature protein
MW of Fusion Proten
12.5 kDa
Expression Region
27-88aa
Expression System
In vitro E.coli
Purity
Greater than 90% as determined by SDS-PAGE.
Tag info
N-terminal 10xHis-tagged
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Recombinant Mouse Apolipoprotein C-I(Apoc1) Images
