*** Online payment is not available now. Please send your PO to order@cusabio.com. We will deal with it soon

Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1)

As low as $368.00
In stock
Product Code
CSB-YP001900HU
Product Code: CSB-YP001900HU
Size: 10μg/100μg/500μg
Species: Homo sapiens (Human)
Express system: Yeast
More Information
Uniprot NO. P27695
Target/Protein APEX1
Species of origin Homo sapiens (Human)
AA Sequence KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Protein description Full length of mature protein
MW of Fusion Proten 34.2 kDa
Expression Region 32-318aa
Expression System Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Tag info N-terminal 6xHis-tagged
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Write Your Own Review
You're reviewing:Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1)
Your Rating