Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

$412.00
In stock
Product Code
CSB-MP028238SBG
Product Inquiry
Product Code: CSB-MP028238SBG
Size: 10μg/50μg/100μg/200μg
Species of origin: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
Application: SDS-PAGE
Express system: Mammalian cell
More Information
Uniprot NO. S4JJH7
Target/Protein A673_03341
Species of origin Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
AA Sequence DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
Biologically Active Not Test
Nature Recombinant
Protein description Partial
MW of Fusion Proten 18.6 kDa
Expression Region 82-220aa
Expression System Mammalian Cell
Purity Greater than 90% as determined by SDS-PAGE.
Application SDS-PAGE
Tag info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reference McClelland M., Porwollik S., Desai P., Cheng P., Wollam A., Pepin K., Palsikar V.B., Fulton L., Fulton R., Delehaunty K., Fronick C., Godfrey J., Waligorski J., Appelbaum E., Tomlinson C., Warren W., Sodergren E., Weinstock G., Wilson R.K.Submitted (APR-2013)
Research areas Others

Write Your Own Review
You're reviewing:Recombinant Salmonella enterica OmpA family protein(A673_03341),partial
Your Rating